Upymes.online valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title UPYMES
Description N/A
Keywords N/A
Server Information
WebSite upymes favicon www.upymes.online
Host IP 184.168.131.241
Location Scottsdale, Arizona, United States
Related Websites
Site Rank
More to Explore
usavisamrvfeepaymentserviceinmexico.wordpress.com
vaguitos-co.myshopify.com
villamaria-caldas.gov.co
visiondelarte.blogspot.com
vite.co.uk
votame.io
vuelaseguro.com
vyphidroasesores.com
wallpaperinstallation.net.au
walmeroptom.co.za
tasukudental.com
team-matrix.jp
Upymes.online Valuation
US$5,015
Last updated: Feb 6, 2021

Upymes.online has global traffic rank of 3,385,600. Upymes.online has an estimated worth of US$ 5,015, based on its estimated Ads revenue. Upymes.online receives approximately 916 unique visitors each day. Its web server is located in Scottsdale, Arizona, United States, with IP address 184.168.131.241. According to SiteAdvisor, upymes.online is unknown to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$5,015
Daily Ads Revenue US$2
Monthly Ads Revenue US$82
Yearly Ads Revenue US$1,003
Daily Unique Visitors 916
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 3,385,600
Delta (90 Days) 0
Most Popular In Country N/A
Country Rank N/A
DNS Records
Host Type TTL Data
upymes.online A 599 IP: 184.168.131.241
upymes.online NS 3599 Target: ns47.domaincontrol.com.
upymes.online NS 3599 Target: ns48.domaincontrol.com.
upymes.online SOA 3599 MNAME: ns47.domaincontrol.com.
RNAME: dns.jomax.net.
Serial: 2021010807
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 600
HTTP Headers
HTTP/1.1 301 Moved Permanently
Server: nginx/1.16.1
Date: Sat, 06 Feb 2021 14:23:48 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: close
Location: https://www.upymes.online

HTTP/2 200 
date: Sat, 06 Feb 2021 14:23:49 GMT
content-type: text/html; charset=utf-8
set-cookie: __cfduid=d0ce3abf7d02287f6fa1216c35d5880aa1612621428; expires=Mon, 08-Mar-21 14:23:48 GMT; path=/; domain=.www.upymes.online; HttpOnly; SameSite=Lax; Secure
status: 200 OK
x-frame-options: ALLOW-FROM https://app.kajabi.com
x-xss-protection: 1; mode=block
x-content-type-options: nosniff
content-security-policy: frame-ancestors 'self' https://app.kajabi.com
x-slug-commit: a62a
cache-control: max-age=0, private, must-revalidate
set-cookie: _kjb_session=a43d4700cecf2e57f152d59773dfe66c; path=/; expires=Sun, 07 Feb 2021 14:23:49 -0000; HttpOnly; Secure; SameSite=None
x-request-id: 86b9f002-a861-447a-9e0d-864b3778fc24
x-runtime: 0.641122
via: 1.1 vegur
cf-cache-status: DYNAMIC
cf-request-id: 0819534fad00001597fcb72000000001
expect-ct: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
server: cloudflare
cf-ray: 61d587f91efe1597-EWR

Upymes.online Whois Information
Domain Name: UPYMES.ONLINE
Registry Domain ID: D199624523-CNIC
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: https://www.godaddy.com/
Updated Date: 2020-10-15T10:58:33.0Z
Creation Date: 2020-09-07T16:51:18.0Z
Registry Expiry Date: 2021-09-07T23:59:59.0Z
Registrar: Go Daddy, LLC
Registrar IANA ID: 146
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Registrant Organization:
Registrant State/Province: Tibas
Registrant Country: CR
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: NS47.DOMAINCONTROL.COM
Name Server: NS48.DOMAINCONTROL.COM
DNSSEC: unsigned
Billing Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4805058800
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

https://www.centralnic.com/support/rdap <<<

The Whois and RDAP services are provided by CentralNic, and contain
information pertaining to Internet domain names registered by our
our customers. By using this service you are agreeing (1) not to use any
information presented here for any purpose other than determining
ownership of domain names, (2) not to store or reproduce this data in
any way, (3) not to use any high-volume, automated, electronic processes
to obtain data from this service. Abuse of this service is monitored and
actions in contravention of these terms will result in being permanently
blacklisted. All data is (c) CentralNic Ltd (https://www.centralnic.com)

Access to the Whois and RDAP services is rate limited. For more
information, visit https://registrar-console.centralnic.com/pub/whois_guidance.